PCMT1 anticorps
-
- Antigène Voir toutes PCMT1 Anticorps
- PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCMT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD
- Top Product
- Discover our top product PCMT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCMT1 Blocking Peptide, catalog no. 33R-1442, is also available for use as a blocking control in assays to test for specificity of this PCMT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))
- Autre désignation
- PCMT1 (PCMT1 Produits)
- Synonymes
- anticorps PIMT, anticorps C79501, anticorps PCM, anticorps PCMT, anticorps etID309741.20, anticorps fj13d06, anticorps pimt, anticorps wu:fj13d06, anticorps protein-L-isoaspartate (D-aspartate) O-methyltransferase, anticorps protein-L-isoaspartate (D-aspartate) O-methyltransferase 1, anticorps protein-L-isoaspartate (D-aspartate) O-methyltransferase L homeolog, anticorps protein-L-isoaspartate(D-aspartate)O-methyltransferase, anticorps PCMT1, anticorps Pcmt1, anticorps pcmt1.L, anticorps pcmt1, anticorps pcmt
- Sujet
- Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-