PLAP anticorps
-
- Antigène Voir toutes PLAP (ALPP) Anticorps
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLAP est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
- Top Product
- Discover our top product ALPP Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALPP Blocking Peptide, catalog no. 33R-9362, is also available for use as a blocking control in assays to test for specificity of this ALPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
- Autre désignation
- ALPP (ALPP Produits)
- Synonymes
- anticorps ECK0378, anticorps JW0374, anticorps psiA, anticorps ALP, anticorps PALP, anticorps PLAP, anticorps PLAP-1, anticorps ILC, anticorps CTACK, anticorps ESkine, anticorps Akp2, anticorps alp, anticorps zgc:56672, anticorps DDBDRAFT_0205491, anticorps DDBDRAFT_0231570, anticorps DDB_0205491, anticorps DDB_0231570, anticorps ALPI, anticorps Actn2lp, anticorps Alp, anticorps bacterial alkaline phosphatase, anticorps alkaline phosphatase, placental, anticorps alkaline phosphatase, placental type, anticorps C-C motif chemokine ligand 27, anticorps alkaline phosphatase, liver/bone/kidney, anticorps alkaline phosphatase, anticorps alkaline phosphatase, intestinal, anticorps PDZ and LIM domain 3, anticorps phoA, anticorps ALPP, anticorps LOC100436725, anticorps CCL27, anticorps alpl, anticorps alp, anticorps ALPI, anticorps Pdlim3, anticorps Alpp
- Sujet
- There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.
- Poids moléculaire
- 59 kDa (MW of target protein)
-