Olfactomedin 4 anticorps (C-Term)

N° du produit ABIN630153

Détail du produit anti-Olfactomedin 4 anticorps

Antigène: Olfactomedin 4 (OLFM4)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Olfactomedin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: OLFM4 antibody was raised against the C terminal of OLFM4

Purification: Purified

Immunogène: OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OLFM4 Blocking Peptide, catalog no. 33R-2362, is also available for use as a blocking control in assays to test for specificity of this OLFM4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Olfactomedin 4

Antigène: Olfactomedin 4 (OLFM4)

Autre désignation: OLFM4 (OLFM4 Produits)

Synonymes: anticorps tiarin, anticorps GC1, anticorps GW112, anticorps OLM4, anticorps OlfD, anticorps UNQ362, anticorps bA209J19.1, anticorps hGC-1, anticorps hOLfD, anticorps Gm296, anticorps Gm913, anticorps pPD4, anticorps olfactomedin-4, anticorps olfactomedin 4 L homeolog, anticorps olfactomedin 4, anticorps olfactomedin-4-like, anticorps olfm4.L, anticorps OLFM4, anticorps olfm4, anticorps LOC100225360, anticorps Olfm4

Sujet: OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.

Poids moléculaire: 55 kDa (MW of target protein)