PSG5 anticorps (N-Term)

N° du produit ABIN630155

Détail du produit anti-PSG5 anticorps

Antigène: PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSG5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PSG5 antibody was raised against the N terminal of PSG5

Purification: Purified

Immunogène: PSG5 antibody was raised using the N terminal of PSG5 corresponding to a region with amino acids QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSG5 Blocking Peptide, catalog no. 33R-7634, is also available for use as a blocking control in assays to test for specificity of this PSG5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSG5

Antigène: PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))

Autre désignation: PSG5 (PSG5 Produits)

Sujet: The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.

Poids moléculaire: 37 kDa (MW of target protein)