PSG1 anticorps (N-Term)

N° du produit ABIN630159

Détail du produit anti-PSG1 anticorps

Antigène: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSG1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PSG1 antibody was raised against the N terminal of PSG1

Purification: Purified

Immunogène: PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSG1 Blocking Peptide, catalog no. 33R-8483, is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSG1

Antigène: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Autre désignation: PSG1 (PSG1 Produits)

Synonymes: anticorps B1G1, anticorps CD66f, anticorps DHFRP2, anticorps FL-NCA-1/2, anticorps PBG1, anticorps PS-beta-C/D, anticorps PS-beta-G-1, anticorps PSBG-1, anticorps PSBG1, anticorps PSG95, anticorps PSGGA, anticorps PSGIIA, anticorps SP1, anticorps PSG1, anticorps PSG10, anticorps PSG12, anticorps Psg, anticorps pregnancy specific beta-1-glycoprotein 1, anticorps pregnancy specific beta-1-glycoprotein 2, anticorps pregnancy specific beta-1-glycoprotein 10, pseudogene, anticorps pregnancy-specific beta 1-glycoprotein, anticorps PSG1, anticorps PSG2, anticorps PSG10P, anticorps Psgb1

Sujet: PSG1 plays an immunomodulatory roles during pregnancy.

Poids moléculaire: 47 kDa (MW of target protein)