PSG1 anticorps (C-Term)
-
- Antigène Voir toutes PSG1 Anticorps
- PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PSG1 antibody was raised against the C terminal of PSG1
- Purification
- Purified
- Immunogène
- PSG1 antibody was raised using the C terminal of PSG1 corresponding to a region with amino acids YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
- Top Product
- Discover our top product PSG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSG1 Blocking Peptide, catalog no. 33R-10182, is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))
- Autre désignation
- PSG1 (PSG1 Produits)
- Synonymes
- anticorps B1G1, anticorps CD66f, anticorps DHFRP2, anticorps FL-NCA-1/2, anticorps PBG1, anticorps PS-beta-C/D, anticorps PS-beta-G-1, anticorps PSBG-1, anticorps PSBG1, anticorps PSG95, anticorps PSGGA, anticorps PSGIIA, anticorps SP1, anticorps PSG1, anticorps PSG10, anticorps PSG12, anticorps Psg, anticorps pregnancy specific beta-1-glycoprotein 1, anticorps pregnancy specific beta-1-glycoprotein 2, anticorps pregnancy specific beta-1-glycoprotein 10, pseudogene, anticorps pregnancy-specific beta 1-glycoprotein, anticorps PSG1, anticorps PSG2, anticorps PSG10P, anticorps Psgb1
- Sujet
- PSG1 plays an immunomodulatory roles during pregnancy.
- Poids moléculaire
- 47 kDa (MW of target protein)
-