SEMG1 anticorps (C-Term)

N° du produit ABIN630166

Détail du produit anti-SEMG1 anticorps

Antigène: SEMG1 (Semenogelin I (SEMG1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEMG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Semenogelin I antibody was raised against the C terminal of SEMG1

Purification: Purified

Immunogène: Semenogelin I antibody was raised using the C terminal of SEMG1 corresponding to a region with amino acids GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Semenogelin I Blocking Peptide, catalog no. 33R-3239, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEMG1

Antigène: SEMG1 (Semenogelin I (SEMG1))

Autre désignation: Semenogelin I (SEMG1 Produits)

Synonymes: anticorps SEMG1, anticorps SEMG1a, anticorps CT103, anticorps SEMG, anticorps SGI, anticorps dJ172H20.2, anticorps RATSVPIIA, anticorps SVPIIA, anticorps SVS2P, anticorps Svp1, anticorps Svs2, anticorps Svs2p2, anticorps BB115391, anticorps Semg1, anticorps SvsII, anticorps semenogelin II, anticorps semenogelin I, anticorps semenogelin-2, anticorps seminal vesicle secretory protein 2, anticorps SEMG2, anticorps SEMG1, anticorps LOC100408385, anticorps Semg1, anticorps Svs2

Sujet: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.

Poids moléculaire: 51 kDa (MW of target protein)