SEMG1 anticorps (C-Term)

N° du produit ABIN630166

Détail du produit anti-SEMG1 anticorps

Antigène: SEMG1 (Semenogelin I (SEMG1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEMG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Semenogelin I antibody was raised against the C terminal of SEMG1

Purification: Purified

Immunogène: Semenogelin I antibody was raised using the C terminal of SEMG1 corresponding to a region with amino acids GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Semenogelin I Blocking Peptide, catalog no. 33R-3239, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEMG1

Antigène: SEMG1 (Semenogelin I (SEMG1))

Autre désignation: Semenogelin I (SEMG1 Produits)

Sujet: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.

Poids moléculaire: 51 kDa (MW of target protein)