Asporin anticorps (Middle Region)
-
- Antigène Voir toutes Asporin (ASPN) Anticorps
- Asporin (ASPN)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Asporin est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Asporin antibody was raised against the middle region of ASPN
- Purification
- Purified
- Immunogène
- Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
- Top Product
- Discover our top product ASPN Anticorps primaire
-
anti-Asporin (ASPN) (AA 16-373) antibody
ASPN Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) (AA 1-384) antibodyASPN Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) (Internal Region) antibodyVerified ASPN Reactivité: Humain, Souris, Rat WB, ELISA, IF Hôte: Chèvre Polyclonal unconjugated
anti-Asporin (ASPN) (AA 33-380) antibodyASPN Reactivité: Humain WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) (AA 242-269) antibodyASPN Reactivité: Humain WB, IF, IHC (p) Hôte: Lapin Polyclonal RB19725 unconjugated
anti-Asporin (ASPN) antibodyASPN Reactivité: Humain, Souris WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) antibodyASPN Reactivité: Humain, Souris, Rat IF Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) antibodyASPN Reactivité: Humain WB, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) (AA 250-299) antibodyASPN Reactivité: Humain, Rat, Chien, Lapin, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Asporin (ASPN) (Middle Region) antibodyASPN Reactivité: Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache), Cobaye, Cheval, Porc, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Asporin Blocking Peptide, catalog no. 33R-6743, is also available for use as a blocking control in assays to test for specificity of this Asporin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Asporin (ASPN)
- Autre désignation
- Asporin (ASPN Produits)
- Synonymes
- anticorps OS3, anticorps PLAP-1, anticorps PLAP1, anticorps SLRR1C, anticorps bgl3, anticorps aspnl, anticorps wu:fk08c11, anticorps zgc:109936, anticorps 4631401G09Rik, anticorps AA986886, anticorps Plap1, anticorps Slrr1c, anticorps os3, anticorps plap-1, anticorps plap1, anticorps slrr1c, anticorps asporin, anticorps asporin (LRR class 1), anticorps asporin L homeolog, anticorps ASPN, anticorps aspn, anticorps Aspn, anticorps aspn.L
- Sujet
- ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.
- Poids moléculaire
- 42 kDa (MW of target protein)
-
