RSAD2 anticorps (N-Term)
-
- Antigène Voir toutes RSAD2 Anticorps
- RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RSAD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RSAD2 antibody was raised against the N terminal of RSAD2
- Purification
- Purified
- Immunogène
- RSAD2 antibody was raised using the N terminal of RSAD2 corresponding to a region with amino acids PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP
- Top Product
- Discover our top product RSAD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RSAD2 Blocking Peptide, catalog no. 33R-7188, is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSAD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))
- Autre désignation
- RSAD2 (RSAD2 Produits)
- Synonymes
- anticorps CIG6, anticorps RSAD2, anticorps 2510004L01Rik, anticorps cig33, anticorps cig5, anticorps vig1, anticorps Vig1, anticorps Best5, anticorps si:ch211-276e8.2, anticorps zgc:112342, anticorps viperin, anticorps rsad2, anticorps radical S-adenosyl methionine domain containing 2, anticorps viperin, anticorps RSAD2, anticorps Rsad2, anticorps rsad2, anticorps vig1
- Sujet
- RSAD2 is a potential antiviral effector.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response
-