GZMH anticorps
-
- Antigène Voir toutes GZMH Anticorps
- GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GZMH est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
- Top Product
- Discover our top product GZMH Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))
- Autre désignation
- Granzyme H (GZMH Produits)
- Synonymes
- anticorps GZMH, anticorps CCP-X, anticorps CGL-2, anticorps CSP-C, anticorps CTLA1, anticorps CTSGL2, anticorps granzyme H, anticorps LOC617313, anticorps GZMH
- Sujet
- This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.
- Poids moléculaire
- 27 kDa (MW of target protein)
-