MCM4 anticorps (C-Term)

N° du produit ABIN630174

Détail du produit anti-MCM4 anticorps

Antigène: MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM4 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCM4 antibody was raised against the C terminal of MCM4

Purification: Purified

Immunogène: MCM4 antibody was raised using the C terminal of MCM4 corresponding to a region with amino acids KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM4 Blocking Peptide, catalog no. 33R-4325, is also available for use as a blocking control in assays to test for specificity of this MCM4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM4

Antigène: MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))

Autre désignation: MCM4 (MCM4 Produits)

Synonymes: anticorps cdc21, anticorps CDC21, anticorps CDC54, anticorps NKCD, anticorps NKGCD, anticorps P1-CDC21, anticorps hCdc21, anticorps 19G, anticorps AI325074, anticorps AU045576, anticorps Cdc21, anticorps Mcmd4, anticorps mKIAA4003, anticorps mcdc21, anticorps cb1025, anticorps fc12c09, anticorps fj85g09, anticorps hm:zeh1616, anticorps wu:fc12c09, anticorps wu:fj85g09, anticorps zeh1616, anticorps minichromosome maintenance complex component 4 L homeolog, anticorps minichromosome maintenance complex component 4 S homeolog, anticorps minichromosome maintenance complex component 4, anticorps mcm4.L, anticorps mcm4.S, anticorps MCM4, anticorps mcm4, anticorps Mcm4

Sujet: The protein encoded by MCM4 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRkDaC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.

Poids moléculaire: 95 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA