KIF1C anticorps (C-Term)

N° du produit ABIN630184

Détail du produit anti-KIF1C anticorps

Antigène: KIF1C (Kinesin Family Member 1C (KIF1C))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF1C est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF1 C antibody was raised against the C terminal of KIF1

Purification: Purified

Immunogène: KIF1 C antibody was raised using the C terminal of KIF1 corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF1C Blocking Peptide, catalog no. 33R-3283, is also available for use as a blocking control in assays to test for specificity of this KIF1C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF1C

Antigène: KIF1C (Kinesin Family Member 1C (KIF1C))

Autre désignation: KIF1C (KIF1C Produits)

Synonymes: anticorps KIF1C, anticorps ltxs1, anticorps DKFZp468E0822, anticorps LTXS1, anticorps B430105J22Rik, anticorps D11Bwg1349e, anticorps Ltxs1, anticorps kinesin family member 1C, anticorps KIF1C, anticorps kif1c, anticorps Kif1c

Sujet: KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.

Poids moléculaire: 123 kDa (MW of target protein)