PRIM1 anticorps (N-Term)

N° du produit ABIN630190

Détail du produit anti-PRIM1 anticorps

Antigène: PRIM1 (Primase, DNA, Polypeptide 1 (49kDa) (PRIM1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRIM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRIM1 antibody was raised against the N terminal of PRIM1

Purification: Purified

Immunogène: PRIM1 antibody was raised using the N terminal of PRIM1 corresponding to a region with amino acids SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRIM1 Blocking Peptide, catalog no. 33R-8737, is also available for use as a blocking control in assays to test for specificity of this PRIM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRIM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRIM1

Antigène: PRIM1 (Primase, DNA, Polypeptide 1 (49kDa) (PRIM1))

Autre désignation: PRIM1 (PRIM1 Produits)

Synonymes: anticorps AI324982, anticorps p49, anticorps dnapol-alpha50, anticorps DNA primase, p49 subunit, anticorps DNA primase subunit 1, anticorps DNA primase subunit 1 S homeolog, anticorps Prim1, anticorps PRIM1, anticorps prim1.S

Sujet: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. PRIM1 is the small, 49 kDa primase subunit.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Telomere Maintenance, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, SARS-CoV-2 Protein Interactome