NOLC1 anticorps (C-Term)
-
- Antigène Voir toutes NOLC1 Anticorps
- NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat, Souris, Chien, Drosophila melanogaster, Arabidopsis
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOLC1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- NOLC1 antibody was raised against the C terminal of NOLC1
- Purification
- Purified
- Immunogène
- NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
- Top Product
- Discover our top product NOLC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOLC1 Blocking Peptide, catalog no. 33R-2089, is also available for use as a blocking control in assays to test for specificity of this NOLC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))
- Autre désignation
- NOLC1 (NOLC1 Produits)
- Synonymes
- anticorps NOPP130, anticorps NOPP140, anticorps NS5ATP13, anticorps P130, anticorps Nopp140, anticorps 3230402K17Rik, anticorps AA408077, anticorps AA536818, anticorps AU046071, anticorps mKIAA0035, anticorps nolc1, anticorps fd05f01, anticorps fi49h02, anticorps nolc1l, anticorps wu:fd05f01, anticorps wu:fi49h02, anticorps NOLC1, anticorps DKFZp459M126, anticorps nopp130, anticorps nopp140, anticorps ns5atp13, anticorps p130, anticorps xNopp180, anticorps nucleolar and coiled-body phosphoprotein 1, anticorps nucleolar and coiled-body phosphoprotein 1 L homeolog, anticorps NOLC1, anticorps Nolc1, anticorps nolc1, anticorps nolc1.L
- Sujet
- Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.
- Poids moléculaire
- 73 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-