LIG4 anticorps (N-Term)

N° du produit ABIN630196

Détail du produit anti-LIG4 anticorps

Antigène: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIG4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: LIG4 antibody was raised against the N terminal of LIG4

Purification: Purified

Immunogène: LIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIG4 Blocking Peptide, catalog no. 33R-1948, is also available for use as a blocking control in assays to test for specificity of this LIG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIG4

Antigène: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Autre désignation: LIG4 (LIG4 Produits)

Synonymes: anticorps zgc:165595, anticorps lig4, anticorps DNA LIGASE IV, anticorps LIG4, anticorps lig4-A, anticorps 5830471N16Rik, anticorps tiny, anticorps DNL4, anticorps ligase IV, DNA, ATP-dependent, anticorps DNA ligase 4, anticorps ATP-dependent DNA ligase implicated in dsDNA break repair via nonhomologous end-joining, anticorps DNA ligase IV, anticorps ligase IV, DNA, ATP-dependent L homeolog, anticorps lig4, anticorps LIG4, anticorps LOC100212302, anticorps CpipJ_CPIJ005161, anticorps PTRG_09982, anticorps MCYG_05151, anticorps LOC657210, anticorps ATLIG4, anticorps lig4.L, anticorps Lig4

Sujet: LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Poids moléculaire: 104 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response