RNASEH2A anticorps (Middle Region)
-
- Antigène Voir toutes RNASEH2A Anticorps
- RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNASEH2A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RNASEH2 A antibody was raised against the middle region of RNASEH2
- Purification
- Purified
- Immunogène
- RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
- Top Product
- Discover our top product RNASEH2A Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNASEH2A Blocking Peptide, catalog no. 33R-1458, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))
- Autre désignation
- RNASEH2A (RNASEH2A Produits)
- Synonymes
- anticorps 2400006P09Rik, anticorps RNASEHI, anticorps RNHIA, anticorps RNHL, anticorps zgc:56307, anticorps AGS4, anticorps JUNB, anticorps ribonuclease H2 subunit A, anticorps ribonuclease H2, large subunit, anticorps ribonuclease H2, subunit A, anticorps ribonuclease H2 subunit A L homeolog, anticorps rnaseh2a, anticorps RNASEH2A, anticorps Rnaseh2a, anticorps rnaseh2a.L
- Sujet
- Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
- Poids moléculaire
- 33 kDa (MW of target protein)
-