TPTE anticorps (C-Term)

N° du produit ABIN630201

Détail du produit anti-TPTE anticorps

Antigène: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPTE est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TPTE antibody was raised against the C terminal of TPTE

Purification: Purified

Immunogène: TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPTE Blocking Peptide, catalog no. 33R-4438, is also available for use as a blocking control in assays to test for specificity of this TPTE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPTE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPTE

Antigène: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Autre désignation: TPTE (TPTE Produits)

Synonymes: anticorps CT44, anticorps PTEN2, anticorps Pten2, anticorps tpip, anticorps vsp, anticorps wu:fd20e11, anticorps wu:fi24b06, anticorps transmembrane phosphatase with tensin homology, anticorps TPTE, anticorps Tpte, anticorps tpte

Sujet: TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Inositol Metabolic Process