Cullin 5 anticorps (C-Term)
-
- Antigène Voir toutes Cullin 5 (CUL5) Anticorps
- Cullin 5 (CUL5)
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cullin 5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cullin 5 antibody was raised against the C terminal of CUL5
- Purification
- Purified
- Immunogène
- Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
- Top Product
- Discover our top product CUL5 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cullin 5 Blocking Peptide, catalog no. 33R-9706, is also available for use as a blocking control in assays to test for specificity of this Cullin 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cullin 5 (CUL5)
- Autre désignation
- Cullin 5 (CUL5 Produits)
- Sujet
- CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.
- Poids moléculaire
- 86 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-