KIFC2 anticorps (N-Term)

N° du produit ABIN630204

Détail du produit anti-KIFC2 anticorps

Antigène: KIFC2 (Kinesin Family Member C2 (KIFC2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIFC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KIFC2 antibody was raised against the N terminal of KIFC2

Purification: Purified

Immunogène: KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIFC2 Blocking Peptide, catalog no. 33R-9783, is also available for use as a blocking control in assays to test for specificity of this KIFC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIFC2

Antigène: KIFC2 (Kinesin Family Member C2 (KIFC2))

Autre désignation: KIFC2 (KIFC2 Produits)

Synonymes: anticorps kinesin family member C2, anticorps Kifc2, anticorps KIFC2

Sujet: Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.

Poids moléculaire: 90 kDa (MW of target protein)