HDAC9 anticorps (C-Term)
-
- Antigène Voir toutes HDAC9 Anticorps
- HDAC9 (Histone Deacetylase 9 (HDAC9))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HDAC9 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- HDAC9 antibody was raised against the C terminal of HDAC9
- Purification
- Purified
- Immunogène
- HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
- Top Product
- Discover our top product HDAC9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HDAC9 Blocking Peptide, catalog no. 33R-7773, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HDAC9 (Histone Deacetylase 9 (HDAC9))
- Autre désignation
- HDAC9 (HDAC9 Produits)
- Synonymes
- anticorps HD7, anticorps HD7b, anticorps HD9, anticorps HDAC, anticorps HDAC7, anticorps HDAC7B, anticorps HDAC9B, anticorps HDAC9FL, anticorps HDRP, anticorps MITR, anticorps AV022454, anticorps D030072B18Rik, anticorps HD7B, anticorps Hdac7b, anticorps Mitr, anticorps mKIAA0744, anticorps hdac9, anticorps zgc:73392, anticorps TWIST, anticorps HDAC9, anticorps DKFZp459E171, anticorps HDA09, anticorps HISTONE DEACETYLASE, anticorps histone deacetylase 9, anticorps RGD1310748, anticorps RGD1563092, anticorps hdac9-A, anticorps histone deacetylase 9, anticorps histone deacetylase 9b, anticorps histone deacetylase 9 S homeolog, anticorps HDAC9, anticorps Hdac9, anticorps hdac9b, anticorps HDA9, anticorps hdac9.S
- Sujet
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-