GNB1L anticorps
-
- Antigène Voir toutes GNB1L Anticorps
- GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNB1L est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- GNB1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA
- Top Product
- Discover our top product GNB1L Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNB1L Blocking Peptide, catalog no. 33R-8245, is also available for use as a blocking control in assays to test for specificity of this GNB1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))
- Autre désignation
- GNB1L (GNB1L Produits)
- Sujet
- GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.
- Poids moléculaire
- 36 kDa (MW of target protein)
-