NSMCE1 anticorps

N° du produit ABIN630218

Détail du produit anti-NSMCE1 anticorps

Antigène: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSMCE1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSMCE1

Antigène: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Autre désignation: NSMCE1 (NSMCE1 Produits)

Synonymes: anticorps zgc:92777, anticorps NSMCE1, anticorps NSE1, anticorps 2510027N19Rik, anticorps RGD1307760, anticorps NSE1 homolog, SMC5-SMC6 complex component, anticorps NSE1 homolog, SMC5-SMC6 complex component L homeolog, anticorps nsmce1, anticorps NSMCE1, anticorps nsmce1.L, anticorps Nsmce1

Sujet: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus