PHAP1 anticorps
-
- Antigène Voir toutes PHAP1 (ANP32A) Anticorps
- PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PHAP1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- ANP32 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI
- Top Product
- Discover our top product ANP32A Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ANP32A Blocking Peptide, catalog no. 33R-5937, is also available for use as a blocking control in assays to test for specificity of this ANP32A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))
- Autre désignation
- ANP32A (ANP32A Produits)
- Synonymes
- anticorps C15orf1, anticorps HPPCn, anticorps I1PP2A, anticorps LANP, anticorps MAPM, anticorps PHAP1, anticorps PHAPI, anticorps PP32, anticorps Anp32, anticorps W91701, anticorps pp32, anticorps Anp32a, anticorps CG5784, anticorps CT18148, anticorps CT42180, anticorps Dmel\\CG5784, anticorps anon-EST:fe3A2, anticorps wu:fj36e08, anticorps zgc:55516, anticorps ANP32D, anticorps acidic nuclear phosphoprotein 32 family member A, anticorps acidic (leucine-rich) nuclear phosphoprotein 32 family, member A, anticorps CG5784 gene product from transcript CG5784-RB, anticorps acidic nuclear phosphoprotein 32 family member A L homeolog, anticorps ANP32A, anticorps Anp32a, anticorps Mapmodulin, anticorps anp32a, anticorps anp32a.L
- Sujet
- ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
- Poids moléculaire
- 29 kDa (MW of target protein)
-