GEM anticorps (C-Term)
-
- Antigène Voir toutes GEM Anticorps
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GEM est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- GEM antibody was raised against the C terminal of GEM
- Purification
- Purified
- Immunogène
- GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
- Top Product
- Discover our top product GEM Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GEM Blocking Peptide, catalog no. 33R-3073, is also available for use as a blocking control in assays to test for specificity of this GEM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
- Autre désignation
- GEM (GEM Produits)
- Sujet
- GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.
- Poids moléculaire
- 33 kDa (MW of target protein)
-