RGS anticorps (N-Term)

N° du produit ABIN630222

Détail du produit anti-RGS anticorps

Antigène: RGS (Regulator of G-Protein Signaling 9 (RGS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RGS9 antibody was raised against the N terminal of RGS9

Purification: Purified

Immunogène: RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS

Antigène: RGS (Regulator of G-Protein Signaling 9 (RGS))

Autre désignation: RGS9 (RGS Produits)

Synonymes: anticorps LOC100218209, anticorps RGS9-1, anticorps Rgs9-2, anticorps PERRS, anticorps RGS9L, anticorps regulator of G-protein signaling 9, anticorps regulator of G protein signaling 9, anticorps RGS9, anticorps Tsp_08067, anticorps Rgs9

Sujet: RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction