RGS anticorps (N-Term)
-
- Antigène Voir toutes RGS Anticorps
- RGS (Regulator of G-Protein Signaling 9 (RGS))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RGS est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RGS9 antibody was raised against the N terminal of RGS9
- Purification
- Purified
- Immunogène
- RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ
- Top Product
- Discover our top product RGS Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RGS (Regulator of G-Protein Signaling 9 (RGS))
- Autre désignation
- RGS9 (RGS Produits)
- Synonymes
- anticorps LOC100218209, anticorps RGS9-1, anticorps Rgs9-2, anticorps PERRS, anticorps RGS9L, anticorps regulator of G-protein signaling 9, anticorps regulator of G protein signaling 9, anticorps RGS9, anticorps Tsp_08067, anticorps Rgs9
- Sujet
- RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
- Poids moléculaire
- 49 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction
-