APCS anticorps (N-Term)

N° du produit ABIN630228

Détail du produit anti-APCS anticorps

Antigène: APCS (Amyloid P Component, Serum (APCS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APCS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: APCS antibody was raised against the N terminal of APCS

Purification: Purified

Immunogène: APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APCS Blocking Peptide, catalog no. 33R-6691, is also available for use as a blocking control in assays to test for specificity of this APCS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APCS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APCS

Antigène: APCS (Amyloid P Component, Serum (APCS))

Autre désignation: APCS (APCS Produits)

Synonymes: anticorps PTX2, anticorps SAP, anticorps Sap, anticorps APCS, anticorps FP, anticorps SAP(FP), anticorps apcs, anticorps ptx2, anticorps sap, anticorps amyloid P component, serum, anticorps serum amyloid P-component, anticorps amyloid P component, serum protein L homeolog, anticorps APCS, anticorps Apcs, anticorps apcs.L

Sujet: APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.

Poids moléculaire: 25 kDa (MW of target protein)