STK3 anticorps
-
- Antigène Voir toutes STK3 Anticorps
- STK3 (serine/threonine Kinase 3 (STK3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STK3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
- Top Product
- Discover our top product STK3 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STK3 Blocking Peptide, catalog no. 33R-3940, is also available for use as a blocking control in assays to test for specificity of this STK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STK3 (serine/threonine Kinase 3 (STK3))
- Autre désignation
- STK3 (STK3 Produits)
- Synonymes
- anticorps KRS1, anticorps MST2, anticorps 0610042I06Rik, anticorps MST, anticorps Mst2, anticorps Mst3, anticorps Ste20, anticorps mess1, anticorps mst2, anticorps xstk3, anticorps wu:fc19e11, anticorps zgc:55383, anticorps serine/threonine kinase 3, anticorps serine/threonine kinase 3 S homeolog, anticorps serine/threonine kinase 3 (STE20 homolog, yeast), anticorps STK3, anticorps Stk3, anticorps stk3.S, anticorps stk3
- Sujet
- Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Tube Formation
-