BDKRB2 anticorps (N-Term)
-
- Antigène Voir toutes BDKRB2 Anticorps
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BDKRB2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2
- Purification
- Purified
- Immunogène
- Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
- Top Product
- Discover our top product BDKRB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Bradykinin Receptor B2 Blocking Peptide, catalog no. 33R-6004, is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDKRB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Autre désignation
- Bradykinin Receptor B2 (BDKRB2 Produits)
- Synonymes
- anticorps BDKRB2, anticorps b2r, anticorps bk2, anticorps bk-2, anticorps bkr2, anticorps brb2, anticorps kinrec, anticorps B2R, anticorps BK-2, anticorps BK2, anticorps BKR2, anticorps BRB2, anticorps B2BKR, anticorps B2BRA, anticorps B(2), anticorps B2, anticorps BK2R, anticorps Bdkrb2, anticorps bradykinin receptor B2, anticorps bradykinin receptor, beta 2, anticorps bradykinin type 2 receptor, anticorps Bdkrb2, anticorps BDKRB2, anticorps bdkrb2, anticorps kinrec, anticorps B2R
- Sujet
- BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-