MGST2 anticorps (N-Term)
-
- Antigène Voir toutes MGST2 Anticorps
- MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MGST2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MGST2 antibody was raised against the N terminal of MGST2
- Purification
- Purified
- Immunogène
- MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
- Top Product
- Discover our top product MGST2 Anticorps primaire
-
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 117-147), (C-Term) antibody
MGST2 Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB17141 unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 27-57) antibodyMGST2 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 1-147) antibodyMGST2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 1-147) antibodyMGST2 Reactivité: Humain ELISA, IP Hôte: Souris Monoclonal 1D11 unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 1-147) antibodyMGST2 Reactivité: Humain ELISA, IP Hôte: Souris Monoclonal 4E1 unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (Internal Region) antibodyMGST2 Reactivité: Humain, Rat, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (N-Term) antibodyMGST2 Reactivité: Humain, Rat, Singe, Boeuf (Vache) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (N-Term) antibodyMGST2 Reactivité: Humain, Rat, Boeuf (Vache), Cheval, Porc WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) antibodyMGST2 Reactivité: Humain WB, IHC, FACS Hôte: Lapin Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (Internal Region) antibodyMGST2 Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MGST2 Blocking Peptide, catalog no. 33R-5664, is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGST2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))
- Autre désignation
- MGST2 (MGST2 Produits)
- Synonymes
- anticorps GST2, anticorps MGST-II, anticorps microsomal glutathione S-transferase 2, anticorps AM1_4050, anticorps MGST2, anticorps Mgst2
- Sujet
- The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.
- Poids moléculaire
- 16 kDa (MW of target protein)
-
