IGSF1 anticorps (N-Term)
-
- Antigène Voir toutes IGSF1 (INHBP) Anticorps
- IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IGSF1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- IGSF1 antibody was raised against the N terminal of IGSF1
- Purification
- Purified
- Immunogène
- IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
- Top Product
- Discover our top product INHBP Anticorps primaire
-
anti-Inhibin Binding Protein (INHBP) (AA 1008-1227) antibody
INHBP Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (AA 220-310) antibodyINHBP Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 4C7 unconjugated
anti-Inhibin Binding Protein (INHBP) antibodyINHBP Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (AA 1270-1297), (C-Term) antibodyINHBP Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB24655 unconjugated
anti-Inhibin Binding Protein (INHBP) (AA 151-200) antibodyINHBP Reactivité: Humain, Rat, Lapin, Cobaye, Cheval, Boeuf (Vache), Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (C-Term) antibodyINHBP Reactivité: Humain, Souris, Rat, Lapin, Chien, Cobaye, Cheval, Boeuf (Vache), Porc, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (AA 324-373) antibodyINHBP Reactivité: Humain, Lapin WB Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (C-Term) antibodyINHBP Reactivité: Humain, Rat, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (N-Term) antibodyINHBP Reactivité: Humain, Souris, Rat, Lapin, Chien, Cobaye, Cheval, Boeuf (Vache), Mouton WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Inhibin Binding Protein (INHBP) (Middle Region) antibodyINHBP Reactivité: Humain, Souris, Rat, Lapin, Chien, Cobaye, Cheval, Boeuf (Vache), Mouton WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IGSF1 Blocking Peptide, catalog no. 33R-4821, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))
- Autre désignation
- IGSF1 (INHBP Produits)
- Synonymes
- anticorps CHTE, anticorps IGCD1, anticorps IGDC1, anticorps INHBP, anticorps PGSF2, anticorps p120, anticorps 5330413N23, anticorps 5530402E03, anticorps AI747649, anticorps InhBP/p120, anticorps mKIAA0364, anticorps Inhbp, anticorps immunoglobulin superfamily member 1, anticorps immunoglobulin superfamily, member 1, anticorps inhibin binding protein, anticorps IGSF1, anticorps Igsf1, anticorps LOC443288
- Sujet
- Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.
- Poids moléculaire
- 27 kDa (MW of target protein)
-
