FXYD5 anticorps (N-Term)

N° du produit ABIN630255

Détail du produit anti-FXYD5 anticorps

Antigène: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FXYD5 est non-conjugé

Application: Western Blotting (WB)

Specificité: FXYD5 antibody was raised against the N terminal of FXYD5

Purification: Purified

Immunogène: FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD

Information d'application

Indications d'application: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FXYD5 Blocking Peptide, catalog no. 33R-5326, is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FXYD5

Antigène: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Autre désignation: FXYD5 (FXYD5 Produits)

Synonymes: anticorps FXYD5, anticorps DYSAD, anticorps IWU1, anticorps KCT1, anticorps OIT2, anticorps PRO6241, anticorps RIC, anticorps EF-8, anticorps Oit2, anticorps FXYD domain containing ion transport regulator 5, anticorps FXYD domain-containing ion transport regulator 5, anticorps FXYD5, anticorps Fxyd5

Sujet: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.

Poids moléculaire: 20 kDa (MW of target protein)