GJB2 anticorps (N-Term)

N° du produit ABIN630258

Détail du produit anti-GJB2 anticorps

Antigène: GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJB2 antibody was raised against the N terminal of GJB2

Purification: Purified

Immunogène: GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJB2 Blocking Peptide, catalog no. 33R-8880, is also available for use as a blocking control in assays to test for specificity of this GJB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJB2

Antigène: GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))

Autre désignation: GJB2 (GJB2 Produits)

Synonymes: anticorps ppk, anticorps cx26, anticorps dfna3, anticorps dfnb1, anticorps nsrd1, anticorps dfna3a, anticorps dfnb1a, anticorps MGC53062, anticorps connexin-26, anticorps GJB2, anticorps AI325222, anticorps Cnx26, anticorps Cx26, anticorps Gjb-2, anticorps CXN-26, anticorps CX26, anticorps DFNA3, anticorps DFNA3A, anticorps DFNB1, anticorps DFNB1A, anticorps HID, anticorps KID, anticorps NSRD1, anticorps PPK, anticorps gap junction protein beta 2 L homeolog, anticorps gap junction protein beta 2, anticorps gap junction protein, beta 2, anticorps gjb2.L, anticorps GJB2, anticorps Gjb2

Sujet: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization