Claudin 15 anticorps (C-Term)

N° du produit ABIN630261

Détail du produit anti-Claudin 15 anticorps

Antigène: Claudin 15 (CLDN15)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 15 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 15 antibody was raised against the C terminal of CLDN15

Purification: Purified

Immunogène: Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 15 Blocking Peptide, catalog no. 33R-4831, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 15

Antigène: Claudin 15 (CLDN15)

Autre désignation: Claudin 15 (CLDN15 Produits)

Synonymes: anticorps CLDN15, anticorps cldn15, anticorps cldn15l, anticorps zgc:63943, anticorps zgc:136755, anticorps 2210009B08Rik, anticorps BB107105, anticorps claudin 15, anticorps claudin 15a, anticorps claudin 15b, anticorps Cldn15, anticorps CLDN15, anticorps cldn15a, anticorps cldn15b

Sujet: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C