GJD2 anticorps (Middle Region)
-
- Antigène Voir toutes GJD2 Anticorps
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GJD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CX36 antibody was raised against the middle region of Cx36
- Purification
- Purified
- Immunogène
- CX36 antibody was raised using the middle region of Cx36 corresponding to a region with amino acids NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA
- Top Product
- Discover our top product GJD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CX36 Blocking Peptide, catalog no. 33R-6905, is also available for use as a blocking control in assays to test for specificity of this CX36 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CX36 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
- Autre désignation
- CX36 (GJD2 Produits)
- Synonymes
- anticorps CX36, anticorps GJA9, anticorps Cx35.1, anticorps Cx36, anticorps GJD2, anticorps Gja9, anticorps connexin36, anticorps cx36, anticorps gap junction protein delta 2, anticorps gap junction protein, delta 2, anticorps GJD2, anticorps Gjd2
- Sujet
- GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.
- Poids moléculaire
- 35 kDa (MW of target protein)
-