Claudin 17 anticorps (Middle Region)

N° du produit ABIN630266

Détail du produit anti-Claudin 17 anticorps

Antigène: Claudin 17 (CLDN17)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 17 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Claudin 17 antibody was raised against the middle region of CLDN17

Purification: Purified

Immunogène: Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 17 Blocking Peptide, catalog no. 33R-4616, is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 17

Antigène: Claudin 17 (CLDN17)

Autre désignation: Claudin 17 (CLDN17 Produits)

Synonymes: anticorps CLDN17, anticorps Claudin-17, anticorps zgc:173444, anticorps claudin 17, anticorps CLDN17, anticorps cldn17, anticorps Cldn17

Sujet: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C