Claudin 9 anticorps (C-Term)

N° du produit ABIN630267

Détail du produit anti-Claudin 9 anticorps

Antigène: Claudin 9 (CLDN9)

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 9 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 9 antibody was raised against the C terminal of CLDN9

Purification: Purified

Immunogène: Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 9 Blocking Peptide, catalog no. 33R-9930, is also available for use as a blocking control in assays to test for specificity of this Claudin 9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 9

Antigène: Claudin 9 (CLDN9)

Autre désignation: Claudin 9 (CLDN9 Produits)

Synonymes: anticorps CLDN9, anticorps nmf329, anticorps claudin 9, anticorps CLDN9, anticorps Cldn9

Sujet: CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C