CLDN8 anticorps (C-Term)

N° du produit ABIN630268

Détail du produit anti-CLDN8 anticorps

Antigène: CLDN8 (Claudin 8 (CLDN8))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLDN8 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Claudin 8 antibody was raised against the C terminal of CLDN8

Purification: Purified

Immunogène: Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV

Information d'application

Indications d'application: WB: 0.5-1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 8 Blocking Peptide, catalog no. 33R-4198, is also available for use as a blocking control in assays to test for specificity of this Claudin 8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLDN8

Antigène: CLDN8 (Claudin 8 (CLDN8))

Autre désignation: Claudin 8 (CLDN8 Produits)

Synonymes: anticorps zgc:91900, anticorps wu:fa01e05, anticorps CLDN8, anticorps AI648025, anticorps claudin 8, anticorps CLDN8, anticorps cldn8, anticorps Cldn8

Sujet: CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Hepatitis C