GJC1 anticorps (N-Term)

N° du produit ABIN630269

Détail du produit anti-GJC1 anticorps

Antigène: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJC1 antibody was raised against the N terminal of GJC1

Purification: Purified

Immunogène: GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJC1 Blocking Peptide, catalog no. 33R-3961, is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJC1

Antigène: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Autre désignation: GJC1 (GJC1 Produits)

Synonymes: anticorps CX45, anticorps GJA7, anticorps cx45, anticorps gja7, anticorps MGC52735, anticorps GJD3, anticorps GJC1, anticorps C130009G16Rik, anticorps Cnx45, anticorps Cx45, anticorps Gja-7, anticorps Gja7, anticorps gap junction protein gamma 1, anticorps gap junction protein gamma 1 L homeolog, anticorps gap junction protein, delta 3, 31.9kDa, anticorps gap junction protein, gamma 1, anticorps Gap junction gamma-1 protein, anticorps GJC1, anticorps gjc1.L, anticorps GJD3, anticorps Gjc1, anticorps gjc1

Sujet: CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization