ITGBL1 anticorps

N° du produit ABIN630272

Détail du produit anti-ITGBL1 anticorps

Antigène: ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGBL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITGBL1 Blocking Peptide, catalog no. 33R-6373, is also available for use as a blocking control in assays to test for specificity of this ITGBL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGBL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGBL1

Antigène: ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))

Autre désignation: ITGBL1 (ITGBL1 Produits)

Synonymes: anticorps ITGBL1, anticorps B930011D01Rik, anticorps OSCP, anticorps TIED, anticorps integrin subunit beta like 1, anticorps integrin, beta-like 1, anticorps integrin subunit beta like 1 L homeolog, anticorps ITGBL1, anticorps Itgbl1, anticorps itgbl1.L

Sujet: The function of ITGBL1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 54 kDa (MW of target protein)