C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) anticorps
-
- Antigène Voir toutes C-Type Lectin Domain Family 4, Member M (CLEC4M) Anticorps
- C-Type Lectin Domain Family 4, Member M (CLEC4M)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- CLEC4 M antibody was raised against the N terminal of CLEC4
- Purification
- Purified
- Immunogène
- CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
- Top Product
- Discover our top product CLEC4M Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLEC4M Blocking Peptide, catalog no. 33R-5525, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C-Type Lectin Domain Family 4, Member M (CLEC4M)
- Autre désignation
- CLEC4M (CLEC4M Produits)
- Synonymes
- anticorps CD209L, anticorps CD299, anticorps DC-SIGN2, anticorps DC-SIGNR, anticorps DCSIGNR, anticorps HP10347, anticorps L-SIGN, anticorps LSIGN, anticorps CD209B, anticorps C-type lectin domain family 4 member M, anticorps CLEC4M
- Sujet
- CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.
- Poids moléculaire
- 44 kDa (MW of target protein)
-