Growth Hormone 2 anticorps (Middle Region)
-
- Antigène Voir toutes Growth Hormone 2 (GH2) Anticorps
- Growth Hormone 2 (GH2)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Growth Hormone 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Growth Hormone 2 antibody was raised against the middle region of GH2
- Purification
- Purified
- Immunogène
- Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
- Top Product
- Discover our top product GH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Growth Hormone 2 Blocking Peptide, catalog no. 33R-6848, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Growth Hormone 2 (GH2)
- Autre désignation
- Growth Hormone 2 (GH2 Produits)
- Synonymes
- anticorps GH-V, anticorps GHL, anticorps GHV, anticorps hGH-V, anticorps growth hormone 2, anticorps GH2
- Classe de substances
- Hormone
- Sujet
- GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Signalistation JAK/STAT, Response to Growth Hormone Stimulus
-