NOV anticorps (C-Term)
-
- Antigène Voir toutes NOV Anticorps
- NOV (Nephroblastoma Overexpressed (NOV))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOV est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NOV antibody was raised against the C terminal of NOV
- Purification
- Purified
- Immunogène
- NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
- Top Product
- Discover our top product NOV Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOV Blocking Peptide, catalog no. 33R-4680, is also available for use as a blocking control in assays to test for specificity of this NOV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOV antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOV (Nephroblastoma Overexpressed (NOV))
- Autre désignation
- NOV (NOV Produits)
- Synonymes
- anticorps CCN3, anticorps IBP-9, anticorps IGFBP-9, anticorps IGFBP9, anticorps NOVh, anticorps nov-A, anticorps xnov, anticorps NovH, anticorps C130088N23Rik, anticorps nephroblastoma overexpressed, anticorps nephroblastoma overexpressed L homeolog, anticorps nephroblastoma overexpressed gene, anticorps NOV, anticorps nov.L, anticorps Nov
- Sujet
- As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Growth Factor Binding
-