SLC39A6 anticorps

N° du produit ABIN630293

Détail du produit anti-SLC39A6 anticorps

Antigène: SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC39 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A6 Blocking Peptide, catalog no. 33R-8173, is also available for use as a blocking control in assays to test for specificity of this SLC39A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A6

Antigène: SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))

Autre désignation: SLC39A6 (SLC39A6 Produits)

Synonymes: anticorps liv1, anticorps wu:fc25a09, anticorps ZIP6, anticorps Ermelin, anticorps LIV-1, anticorps solute carrier family 39 (zinc transporter), member 6, anticorps solute carrier family 39 member 6, anticorps solute carrier family 39 (metal ion transporter), member 6, anticorps slc39a6, anticorps SLC39A6, anticorps Slc39a6

Sujet: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis