SLC35C1 anticorps (N-Term)

N° du produit ABIN630296

Détail du produit anti-SLC35C1 anticorps

Antigène: SLC35C1 (Solute Carrier Family 35, Member C1 (SLC35C1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35C1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 C1 antibody was raised against the N terminal of SLC35 1

Purification: Purified

Immunogène: SLC35 C1 antibody was raised using the N terminal of SLC35 1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35C1 Blocking Peptide, catalog no. 33R-9287, is also available for use as a blocking control in assays to test for specificity of this SLC35C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35C1

Antigène: SLC35C1 (Solute Carrier Family 35, Member C1 (SLC35C1))

Autre désignation: SLC35C1 (SLC35C1 Produits)

Synonymes: anticorps CDG2C, anticorps FUCT1, anticorps E430007K15Rik, anticorps fuct1, anticorps GDP-Fuc-Tr, anticorps SLC35C1, anticorps wu:fc03b12, anticorps zgc:101867, anticorps solute carrier family 35 member C1, anticorps GDP-fucose transporter 1, anticorps hypothetical protein, anticorps solute carrier family 35, member C1, anticorps solute carrier family 35 (GDP-fucose transporter), member C1, anticorps SLC35C1, anticorps Chro.40354, anticorps PGTG_17642, anticorps Tsp_08269, anticorps Slc35c1, anticorps slc35c1

Sujet: SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen.

Poids moléculaire: 40 kDa (MW of target protein)