MFAP3L anticorps (N-Term)

N° du produit ABIN630299

Détail du produit anti-MFAP3L anticorps

Antigène: MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFAP3L est non-conjugé

Application: Western Blotting (WB)

Specificité: MFAP3 L antibody was raised against the N terminal of MFAP3

Purification: Purified

Immunogène: MFAP3 L antibody was raised using the N terminal of MFAP3 corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MFAP3L Blocking Peptide, catalog no. 33R-6090, is also available for use as a blocking control in assays to test for specificity of this MFAP3L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFAP3L

Antigène: MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))

Autre désignation: MFAP3L (MFAP3L Produits)

Synonymes: anticorps NYD-sp9, anticorps 4933428A15Rik, anticorps 5430405D20Rik, anticorps AI461995, anticorps AW125052, anticorps mKIAA0626, anticorps microfibril associated protein 3 like, anticorps microfibril associated protein 3 like S homeolog, anticorps microfibrillar associated protein 3 like, anticorps microfibrillar-associated protein 3-like, anticorps MFAP3L, anticorps mfap3l.S, anticorps Mfap3l

Sujet: The function of MFAP3L protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 45 kDa (MW of target protein)