ZFYVE27 anticorps (Middle Region)

N° du produit ABIN630302

Détail du produit anti-ZFYVE27 anticorps

Antigène: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZFYVE27 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZFYVE27 antibody was raised against the middle region of ZFYVE27

Purification: Purified

Immunogène: ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZFYVE27 Blocking Peptide, catalog no. 33R-9554, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZFYVE27

Antigène: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Autre désignation: ZFYVE27 (ZFYVE27 Produits)

Synonymes: anticorps ZFYVE27, anticorps MGC130947, anticorps spg33, anticorps im:7137347, anticorps zgc:153156, anticorps PROTRUDIN, anticorps RP11-459F3.2, anticorps SPG33, anticorps 2210011N02Rik, anticorps 9530077C24Rik, anticorps AI426636, anticorps AI593546, anticorps AI835681, anticorps zinc finger FYVE-type containing 27, anticorps zinc finger FYVE domain containing 27 L homeolog, anticorps zinc finger FYVE domain containing 27, anticorps zinc finger, FYVE domain containing 27, anticorps ZFYVE27, anticorps zfyve27.L, anticorps zfyve27, anticorps Zfyve27

Sujet: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway