SLC12A2 anticorps

N° du produit ABIN630304

Détail du produit anti-SLC12A2 anticorps

Antigène: SLC12A2 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC12A2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: SLC12 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC12A2 Blocking Peptide, catalog no. 33R-3991, is also available for use as a blocking control in assays to test for specificity of this SLC12A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC12A2

Antigène: SLC12A2 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2))

Autre désignation: SLC12A2 (SLC12A2 Produits)

Synonymes: anticorps BSC, anticorps BSC2, anticorps NKCC1, anticorps Bsc2, anticorps Nkcc1, anticorps bsc2, anticorps 9330166H04Rik, anticorps mBSC2, anticorps sy-ns, anticorps solute carrier family 12 member 2, anticorps solute carrier family 12, member 2, anticorps SLC12A2, anticorps Slc12a2

Sujet: By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.

Poids moléculaire: 131 kDa (MW of target protein)

Pathways: Sensory Perception of Sound