MGC39633 (N-Term) anticorps

N° du produit ABIN630310

Détail du produit

Antigène: MGC39633

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: MGC39633 antibody was raised against the N terminal Of Mgc39633

Purification: Purified

Immunogène: MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC39633 Blocking Peptide, catalog no. 33R-9790, is also available for use as a blocking control in assays to test for specificity of this MGC39633 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC39633 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: MGC39633

Sujet: The function of MGC39633 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 62 kDa (MW of target protein)