KIAA0319 anticorps (N-Term)

N° du produit ABIN630311

Détail du produit anti-KIAA0319 anticorps

Antigène: KIAA0319

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIAA0319 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KIAA0319 antibody was raised against the N terminal of KIAA0319

Purification: Purified

Immunogène: KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0319 Blocking Peptide, catalog no. 33R-2376, is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0319 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIAA0319

Antigène: KIAA0319

Autre désignation: KIAA0319 (KIAA0319 Produits)

Synonymes: anticorps DYLX2, anticorps DYX2, anticorps 4930451E12Rik, anticorps Kiaa0319, anticorps KIAA0319, anticorps RIKEN cDNA D130043K22 gene, anticorps KIAA0319 ortholog, anticorps similar to mKIAA0319 protein, anticorps KIAA0319, anticorps D130043K22Rik, anticorps RGD1307443

Sujet: KIAA0319 has been strongly associated with developmental dyslexia.

Poids moléculaire: 56 kDa (MW of target protein)