NrCAM anticorps (N-Term)

N° du produit ABIN630314

Détail du produit anti-NrCAM anticorps

Antigène: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NrCAM est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: NRCAM antibody was raised against the N terminal of NRCAM

Purification: Purified

Immunogène: NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRCAM Blocking Peptide, catalog no. 33R-6774, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NrCAM

Antigène: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Autre désignation: NRCAM (NRCAM Produits)

Synonymes: anticorps CD56, anticorps MSK39, anticorps NCAM, anticorps Bravo, anticorps C030017F07Rik, anticorps C130076O07Rik, anticorps mKIAA0343, anticorps NRCAM, anticorps si:dkey-240a12.1, anticorps Nr-CAM, anticorps neural cell adhesion molecule 1, anticorps neuronal cell adhesion molecule, anticorps neuronal cell adhesion molecule L homeolog, anticorps neuronal cell adhesion molecule a, anticorps NCAM1, anticorps NRCAM, anticorps Nrcam, anticorps nrcam.L, anticorps nrcama, anticorps nrcam

Sujet: Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

Poids moléculaire: 141 kDa (MW of target protein)

Pathways: Regulation of Cell Size